Molecular Development - Rubella Genome

From Embryology
Embryology - 25 Aug 2019    Facebook link Pinterest link Twitter link  Expand to Translate  
Google Translate - select your language from the list shown below (this will open a new external page)

العربية | català | 中文 | 中國傳統的 | français | Deutsche | עִברִית | हिंदी | bahasa Indonesia | italiano | 日本語 | 한국어 | မြန်မာ | Pilipino | Polskie | português | ਪੰਜਾਬੀ ਦੇ | Română | русский | Español | Swahili | Svensk | ไทย | Türkçe | اردو | ייִדיש | Tiếng Việt    These external translations are automated and may not be accurate. (More? About Translations)

Introduction

Rubella Virus EM
Rubella Virus, transmission electron micrograph (Image: CDC USA)

The complete genomic sequence of Rubella is now known.[1] Rubella is a 9755 bp single stranded RNA positive-strand virus with no DNA stage (Togaviridae; Rubivirus) encoding non-structural protein, capsid protein, glycoproteins E1 and E2.


Abnormal Development - Rubella Virus


Viral Links: viral infection | TORCH | cytomegalovirus | hepatitis | HIV | parvovirus | polio | rubella virus | chickenpox | Lymphocytic Choriomeningitis Virus | Zika virus | human papillomavirus | rotavirus | vaccination | varicella virus | environment
Historic Embryology - Viral 
1941 Rubella Cataracts | 1944 Rubella Defects

Lineage

Lineage: Viruses; ssRNA viruses; ssRNA positive-strand viruses, no DNA stage; Togaviridae; Rubivirus; Rubella virus

Sequence Information

Sequence of the genome RNA of rubella virus: evidence for genetic rearrangement during toga virus evolution

Virology. 1990 Jul;177(1):225-38.

Dominguez G, Wang CY, Frey TK. Source Department of Biology, Georgia State University, Atlanta 30302-4010.

Abstract

The nucleotide sequence of the rubella virus (RUB) genomic RNA was determined. The RUB genomic RNA is 9757 nucleotides in length [excluding the poly(A) tail] and has a G/C content of 69.5%, the highest of any RNA virus sequenced to date. The RUB genomic RNA contains two long open reading frames (ORFs), a 5'-proximal ORF of 6656 nucleotides and a 3'-proximal ORF of 3189 nucleotides which encodes the structural proteins. Thus, the genomic organization of RUB is similar to that of alphaviruses, the other genus of the Togavirus family, and the 5'-proximal ORF of RUB therefore putatively codes for the nonstructural proteins. Sequences homologous to three regions of nucleotide sequence highly conserved among alphaviruses (a stem-and-loop structure at the 5' end of the genome, a 51-nucleotide conserved sequence near the 5' end of the genome, and a 20-nucleotide conserved sequence at the subgenomic RNA start site) were found in the RUB genomic RNA. Amino acid sequence comparisons between the nonstructural ORF of RUB and alphaviruses revealed only one short (122 amino acids) region of significant homology, indicating that these viruses are only distantly related. This region of homology is located at the NH2 terminus of nsP3 in the alphavirus genome. The RUB nonstructural protein ORF contains two global amino acid motifs conserved in a large number of positive-polarity RNA viruses, a motif indicative of helicase activity and a motif indicative of replicase activity. The order of the helicase motif and the nsP3 homology region in the RUB genome is reversed with respect to the alphavirus genome indicating that a genetic rearrangement has occurred during the evolution of these viruses.

PMID 2353453

LOCUS RUBCG 9755 bp ss-RNA VRL 08-MAR-1996

DEFINITION Rubella virus complete genome encoding nonstructural protein, capsid protein, glycoproteins E1 and E2, complete cds.

ACCESSION M15240 M18901 M32735

NID g333971 VERSION M15240.1 GI:333971

KEYWORDS C gene; capsid protein; glycoprotein; glycoprotein E1; glycoprotein E2; haemagglutinin; nonstructural protein.

SOURCE ORGANISM Rubella virus

Viruses; ssRNA positive-strand viruses, no DNA stage; Togaviridae; Rubivirus.

Protein Sequence

source 1..9755
/organism="Rubella virus"
/note="other clones: pRUB1010[1012, 1002, 1006, 1015,
1001]"
/db_xref="taxon:11041"
/clone="pRUB1025"
CDS 39..6656
/note="nonstructural polyprotein precursor"
/codon_start=1
/protein_id="AAA88528.1"
/db_xref="PID:g333972"
/db_xref="GI:333972"
/translation="MEKLLDEVLAPGGPYNLTVGSWVRDHVRSIVEGAWEVRDVVTAA
QKRAIVAVIPRPVFTQMQVSDHPALHAISRYTRRHWIEWGPKEALHVLIDPSPGLLRE
VARVERRWVALCLHRTARKLATALAETASEAWHADYVCALRGAPSGPFYVHPEDVPHG
GRAVADRCLLYYTPMQMCELMRTIDATLLVAVDLWPVALAAHVGDDWDDLGIAWHLDH
DGGCPADCRGAGAGPTPGYTRPCTTRIYQVLPDTAHPGRLYRCGPRLWTRDCAVAELS
WEVAQHCGHQARVRAVRCTLPIRHVRSLQPSARVRLPDLVHLAEVGRWRWFSLPRPVF
QRMLSYCKTLSPDAYYSERVFKFKNALCHSITLAGNVLQEGWKGTCAEEDALCAYVAF
RAWQSNARLAGIMKGAKCAADSLSVAGWLDTIWDAIKRFLGSVPLAERMEEWEQDAAV
AAFDRGPLEDGGRHLDTVQPPKSPPRPEIAATWIVHAASEDRHCACAPRCDVPRERPS
APAGQPDDEALIPPWLFAERRALRCREWDFEALRARADTAAAPAPPAPRPARYPTVLY
RHPAHHGPWLTLDEPGEADAALVLCDPLGQPLRGPERHFAAGAHMCAQARGLQAFVRV
VPPPERPWADGGARAWAKFFRGCAWAQRLLGEPAVMHLPYTDGDVPQLIALALRTLAQ
QGAALALSVRDLPGGAAFDANAVTAAVRAGPRQSAAASPPPGDPPPPRRARRSQRHSD
ARGTPPPAPARDPPPPAPSPPAPPRAGDPVPPIPAGPADRARDAELEVACEPSGPPTS
TRADPDSDIVESYARAAGPVHLRVRDIMDPPPGCKVVVNAANEGLLAGSGVCGAIFAN
ATAALAANCRRLAPCPTGEAVATPGHGCGYTHIIHAVAPRRPRDPAALEEGEALLERA
YRSIVALAAARRWACVACPLLGAGVYGWSAAESLRAALAATRTEPVERVSLHICHPDR
ATLTHASVLVGAGLAARRVSPPPTEPLASCPAGDPGRPAQRSASPPATPLGDATAPEP
RGCQGCELCRYTRVTNDRAYVNLWLERDRGATSWAMRIPEVVVYGPEHLATHFPLNHY
SVLKPAEVRPPRGMCGSDMWRCRGWHGMPQVRCTPSNAHAALCRTGVPPRASTRGGEL
DPNTCWLRAAANVAQAARACGAYTSAGCPKCAYGRALSEARTHEDFAALSQRWSASHA
DASPDGTGDPLDPLMETVGCACSRVWVGSEHEAPPDHLLVSLHRAPNGPWGVVLEVRA
RPEGGNPTGHFVCAVGGGPRRVSDRPHLWLAVPLSRGGGTCAATDEGLAQAYYDDLEV
RRLGDDAMARAALASVQRPRKGPYNIRVWNMAAGAGKTTRILAAFTREDLYVCPTNAL
LHEIQAKLRARDIDIKNAATYERRLTKPLAAYRRIYIDEAFTLGGEYCAFVASQTTAE
VICVGDRDQCGPHYANNCRTPVPDRWPTERSRHTWRFPDCWAARLRAGLDYDIEGERT
GTFACNLWDGRQVDLHLAFSRETVRRLHEAGIRAYTVREAQGMSVGTACIHVGRDGTD
VALALTRDLAIVSLTRASDALYLHELEDGSLRAAGLSAFLDAGALAELKEVPAGIDRV
VAVEQAPPPLPPADGIPEAQDVPPFCPRTLEELVFGRAGHPHYADLNRVTEGEREVRY
MRISRHLLNKNHTEMPGTERVLSAVCAVRRYRAGEDGSTLRTAVARQHPRPFRQIPPP
RVTAGVAQEWRMTYLRERIDLTDVYTQMGVAARELTDRYARRYPEIFAGMCTAQSLSV
PAFLKATLKCVDAALGPRDTEDCHAAQGKAGLEIRAWAKEWVQVMSPHFRAIQKIIMR
ALRPQFLVAAGHTEPEVDAWWQAHYTTNAIEVDFTEFDMNQTLATRDVELEISAALLG
LPCAEDYRALRAGSYCTLRELGSTETGCERTSGEPATLLHNTTVAMCMAMRMVPKGVR
WAGIFQGDDMVIFLPEGARSAALKWTPAEVGLFGFHIPVKHVSTPTPSFCGHVGTAAG
LFHDVMHQAIKVLCRRFDPDVLEEQQVALLDRLRGVYAALPDTVAANAAYYDYSAERV
LAIVRELTAYAGARPRPPGHHRRARGDSDPLRARQSPRRRLTPLYVGPLILPTLTRSS
PTVVSPHLVGTQLLPFGRAPGCPNGFYYPHHHGGPPEGPRGTIPRPARGTRRRRLAVA
PAAAAATARLQHLRR"
mRNA 6428..9755
/note="subgenomic RNA"
mat_peptide 6505..7404
/note="capsid protein (C)"
CDS 6505..9696
/note="structural polyprotein precursor"
/codon_start=1
/protein_id="AAA88529.1"
/db_xref="PID:g333973"
/db_xref="GI:333973"
/translation="MASTTPITMEDLQKALEAQSRALRAELAAGASQSRRPRPPRQRD

SSTSGDDSGRDSGGPRRRRGNRGRGQRRDWSRAPPPPEERQETRSQTPAPKPSRAPPQ

QPQPPRMQTGRGGSAPRPELGPPTNPFQAAVARGLRPPLHDPDTEAPTEACVTSWLWS

EGEGAVFYRVDLHFTNLGTPPLDEDGRWDPALMYNPCGPEPPAHVVRAYNQPAGDVRG

VWGKGERTYAEQDFRVGGTRWHRLLRMPVRGLDGDSAPLPPHTTERIETRSARHPWRI

RFGAPQAFLAGLLLATVAVGTARAGLQPRADMAAPPTLPQPPCAHGQHYGHHHHQLPF

LGHDGHHGGTLRVGQHYRNASDVLPGHWLQGGWGCYNLSDWHQGTHVCHTKHMDFWCV

EHDRPPPATPTPLTTAANSTTAATPATAPAPCHAGLNDSCGGFLSGCGPMRLRHGADT

RCGRLICGLSTTAQYPPTRFGCAMRWGLPPWELVVLTARPEDGWTCRGVPAHPGARCP

ELVSPMGRATCSPASALWLATANALSLDHALAAFVLLVPWVLIFMVCRRACRRRGAAA

ALTAVVLQGYNPPAYGEEAFTYLCTAPGCATQAPVPVRLAGVRFESKIVDGGCFAPWD

LEATGACICEIPTDVSCEGLGAWVPAAPCARIWNGTQRACTFWAVNAYSSGGYAQLAS

YFNPGGSYYKQYHPTACEVEPAFGHSDAACWGFPTDTVMSVFALASYVQHPHKTVRVK

FHTETRTVWQLSVAGVSCNVTTEHPFCNTPHGQLEVQVPPDPGDLVEYIMNYTGNQQS

RWGLGSPNCHGPDWASPVCQRHSPDCSRLVGATPERPRLRLVDADDPLLRTAPGPGEV

WVTPVIGSQARKCGLHIRAGPYGHATVEMPEWIHAHTTSDPWHPPGPLGLKFKTVRPV

ALPRTLAPPRNVRVTGCYQCGTPALVEGLAPGGGNCHLTVNGEDLGAVPPGKFVTAAL

LNTPPPYQVSCGGESDRATARVIDPAAQSFTGVVYGTHTTAVSETRQTWAEWAAAHWW

QLTLGAICALPLAGLLACCAKCLYYLRGAIAPR"


mat_peptide 7405..8250 ="glycoprotein E2"

mat_peptide 8251..9693 ="glycoprotein E1"


Nucleotide Sequence


BASE COUNT 1457 a 3781 c 3007 g 1510 t

ORIGIN

1 atggaagcta tcggacctcg cttaggactc ccattcccat ggagaaactc ctagatgagg

61 ttcttgcccc cggtgggcct tataacttaa ccgtcggcag ttgggtaaga gaccacgtcc

121 gatcaattgt cgagggcgcg tgggaagtgc gcgatgttgt taccgctgcc caaaagcggg

181 ccatcgtagc cgtgataccc agacctgtgt tcacgcagat gcaggtcagt gatcacccag

241 cactccacgc aatttcgcgg tatacccgcc gccattggat cgagtggggc cctaaagaag

301 ccctacacgt cctcatcgac ccaagcccgg gcctgctccg cgaggtcgct cgcgttgagc

361 gccgctgggt cgcactgtgc ctccacagga cggcacgcaa actcgccacc gccctggccg

421 agacggccag cgaggcgtgg cacgctgact acgtgtgcgc gctgcgtggc gcaccgagcg

481 gccccttcta cgtccaccct gaggacgtcc cgcacggcgg tcgcgccgtg gcggacagat

541 gcttgctcta ctacacaccc atgcagatgt gcgagctgat gcgtaccatt gacgccaccc

601 tgctcgtggc ggttgacttg tggccggtcg cccttgcggc ccacgtcggc gacgactggg

661 acgacctggg cattgcctgg catctcgacc atgacggcgg ttgccccgcc gattgccgcg

721 gagccggcgc tgggcccacg cccggctaca cccgcccctg caccacacgc atctaccaag

781 tcctgccgga caccgcccac cccgggcgcc tctaccggtg cgggccccgc ctgtggacgc

841 gcgattgcgc cgtggccgaa ctctcatggg aggttgccca acactgcggg caccaggcgc

901 gcgtgcgcgc cgtgcgatgc accctcccta tccgccacgt gcgcagcctc caacccagcg

961 cgcgggtccg actcccggac ctcgtccatc tcgccgaggt gggccggtgg cggtggttca

1021 gcctcccccg ccccgtgttc cagcgcatgc tgtcctactg caagaccctg agccccgacg

1081 cgtactacag cgagcgcgtg ttcaagttca agaacgccct gtgccacagc atcacgctcg

1141 cgggcaatgt gctgcaagag gggtggaagg gcacgtgcgc cgaggaagac gcgctgtgcg

1201 catacgtagc cttccgcgcg tggcagtcta acgccaggtt ggcggggatt atgaaaggcg

1261 cgaagtgcgc cgccgactct ttgagcgtgg ccggctggct ggacaccatt tgggacgcca

1321 ttaagcggtt cctcggtagc gtgcccctcg ccgagcgcat ggaggagtgg gaacaggacg

1381 ccgcggtcgc cgccttcgac cgcggccccc tcgaggacgg cgggcgccac ttggacaccg

1441 tgcaaccccc aaaatcgccg ccccgccctg agatcgccgc gacctggatc gtccacgcag

1501 ccagcgaaga ccgccattgc gcgtgcgctc cccgctgcga cgtcccgcgc gaacgtcctt

1561 ccgcgcccgc cggccagccg gatgacgagg cgctcatccc gccgtggctg ttcgccgagc

1621 gccgtgccct ccgctgccgc gagtgggatt tcgaggctct ccgcgcgcgc gccgatacgg

1681 cggccgcgcc cgccccgccg gctccacgcc ccgcgcggta ccccaccgtg ctctaccgcc

1741 accccgccca ccacggcccg tggctcaccc ttgacgagcc gggcgaggct gacgcggccc

1801 tggtcttatg cgacccactt ggccagccgc tccggggccc tgaacgccac ttcgccgccg

1861 gcgcgcatat gtgcgcgcag gcgcgggggc tccaggcttt tgtccgtgtc gtgcctccac

1921 ccgagcgccc ctgggccgac gggggcgcca gagcgtgggc gaagttcttc cgcggctgcg

1981 cctgggcgca gcgcttgctc ggcgagccag cagttatgca cctcccatac accgatggcg

2041 acgtgccaca gctgatcgca ctggctttgc gcacgctggc ccaacagggg gccgccttgg

2101 cactctcggt gcgtgacctg cccgggggtg cagcgttcga cgcaaacgcg gtcaccgccg

2161 ccgtgcgcgc tggcccccgc cagtccgcgg ccgcgtcacc gccacccggc gaccccccgc

2221 cgccgcgccg cgcacggcga tcgcaacggc actcggacgc tcgcggcact ccgccccccg

2281 cgcctgcgcg cgacccgccg ccgcccgccc ccagcccgcc cgcgccaccc cgcgctggtg

2341 acccggtccc tcccattccc gcggggccgg cggatcgcgc gcgtgacgcc gagctggagg

2401 tcgcctgcga gccgagcggc ccccccacgt caaccagggc agacccagac agcgacatcg

2461 ttgaaagtta cgcccgcgcc gccggacccg tgcacctccg agtccgcgac atcatggacc

2521 caccgcccgg ctgcaaggtc gtggtcaacg ccgccaacga ggggctactg gccggctctg

2581 gcgtgtgcgg tgccatcttt gccaacgcca cggcggccct cgctgcaaac tgccggcgcc

2641 tcgccccatg ccccaccggc gaggcagtgg cgacacccgg ccacggctgc gggtacaccc

2701 acatcatcca cgccgtcgcg ccgcggcgtc ctcgggaccc cgccgccctc gaggagggcg

2761 aagcgctgct cgagcgcgcc taccgcagca tcgtcgcgct agccgccgcg cgtcggtggg

2821 cgtgtgtcgc gtgccccctc ctcggcgctg gcgtctacgg ctggtctgct gcggagtccc

2881 tccgagccgc gctcgcggct acgcgcaccg agcccgtcga gcgcgtgagc ctgcacatct

2941 gccaccccga ccgcgccacg ctgacgcacg cctccgtgct cgtcggcgcg gggctcgctg

3001 ccaggcgcgt cagtcctcct ccgaccgagc ccctcgcatc ttgccccgcc ggtgacccgg

3061 gccgaccggc tcagcgcagc gcgtcgcccc cagcgacccc ccttggggat gccaccgcgc

3121 ccgagccccg cggatgccag gggtgcgaac tctgccggta cacgcgcgtc accaatgacc

3181 gcgcctatgt caacctgtgg ctcgagcgcg accgcggcgc caccagctgg gccatgcgca

3241 ttcccgaggt ggttgtctac gggccggagc acctcgccac gcattttcca ttaaaccact

3301 acagtgtgct caagcccgcg gaggtcaggc ccccgcgagg catgtgcggg agtgacatgt

3361 ggcgctgccg cggctggcat ggcatgccgc aggtgcggtg caccccctcc aacgctcacg

3421 ccgccctgtg ccgcacaggc gtgccccctc gggcgagcac gcgaggcggc gagctagacc

3481 caaacacctg ctggctccgc gccgccgcca acgttgcgca ggctgcgcgc gcctgcggcg

3541 cctacacgag tgccgggtgc cccaagtgcg cctacggccg cgccctgagc gaagcccgca

3601 ctcatgagga cttcgccgcg ctgagccagc ggtggagcgc gagccacgcc gatgcctccc

3661 ctgacggcac cggagatccc ctcgaccccc tgatggagac cgtgggatgc gcctgttcgc

3721 gcgtgtgggt cggctccgag catgaggccc cgcccgacca cctcctggtg tcccttcacc

3781 gtgccccaaa tggtccgtgg ggcgtagtgc tcgaggtgcg tgcgcgcccc gaggggggca

3841 accccaccgg ccacttcgtc tgcgcggtcg gcggcggccc acgccgcgtc tcggaccgcc

3901 cccacctctg gcttgcggtc cccctgtctc ggggcggtgg cacctgtgcc gcgaccgacg

3961 aggggctggc ccaggcgtac tacgacgacc tcgaggtgcg ccgcctcggg gatgacgcca

4021 tggcccgggc ggccctcgca tcagtccaac gccctcgcaa aggcccttac aatatcaggg

4081 tatggaacat ggccgcaggc gctggcaaga ctacccgcat cctcgctgcc ttcacgcgcg

4141 aagaccttta cgtctgcccc accaatgcgc tcctgcacga gatccaggcc aaactccgcg

4201 cgcgcgatat cgacatcaag aacgccgcca cctacgagcg ccggctgacg aaaccgctcg

4261 ccgcctaccg ccgcatctac atcgatgagg cgttcactct cggcggcgag tactgcgcgt

4321 tcgttgccag ccaaaccacc gcggaggtga tctgcgtcgg tgatcgggac cagtgcggcc

4381 cacactacgc caataactgc cgcacccccg tccctgaccg ctggcctacc gagcgctcgc

4441 gccacacttg gcgcttcccc gactgctggg cggcccgcct gcgcgcgggg ctcgattatg

4501 acatcgaggg cgagcgcacc ggcaccttcg cctgcaacct ttgggacggc cgccaggtcg

4561 accttcacct cgccttctcg cgcgaaaccg tgcgccgcct tcacgaggct ggcatacgcg

4621 catacaccgt gcgcgaggcc cagggtatga gcgtcggcac cgcctgcatc catgtaggca

4681 gagacggcac ggacgttgcc ctggcgctga cacgcgacct cgccatcgtc agcctgaccc

4741 gggcctccga cgcactctac ctccacgagc tcgaggacgg ctcactgcgc gctgcggggc

4801 tcagcgcgtt cctcgacgcc ggggcactgg cggagctcaa ggaggttccc gctggcattg

4861 accgcgttgt cgccgtcgag caggcaccac caccgttgcc gcccgccgac ggcatccccg

4921 aggcccaaga cgtgccgccc ttctgccccc gcactctgga ggagctcgtc ttcggccgtg

4981 ccggccaccc ccattacgcg gacctcaacc gcgtgactga gggcgaacga gaagtgcggt

5041 acatgcgcat ctcgcgtcac ctgctcaaca agaatcacac cgagatgccc ggaacggaac

5101 gcgttctcag tgccgtttgc gccgtgcggc gctaccgcgc gggcgaggat gggtcgaccc

5161 tccgcactgc tgtggcccgc cagcacccgc gcccttttcg ccagatccca cccccgcgcg

5221 tcactgctgg ggtcgcccag gagtggcgca tgacgtactt gcgggaacgg atcgacctca

5281 ctgatgtcta cacgcagatg ggcgtggccg cgcgggagct caccgaccgc tacgcgcgcc

5341 gctatcctga gatcttcgcc ggcatgtgta ccgcccagag cctgagcgtc cccgccttcc

5401 tcaaagccac cttgaagtgc gtagacgccg ccctcggccc cagggacacc gaggactgcc

5461 acgccgctca ggggaaagcc ggccttgaga tccgggcgtg ggccaaggag tgggttcagg

5521 ttatgtcccc gcatttccgc gcgatccaga agatcatcat gcgcgccttg cgcccgcaat

5581 tccttgtggc cgctggccat acggagcccg aggtcgatgc gtggtggcag gcccattaca

5641 ccaccaacgc catcgaggtc gacttcactg agttcgacat gaaccagacc ctcgctactc

5701 gggacgtcga gctcgagatt agcgccgctc tcttgggcct cccttgcgcc gaagactacc

5761 gcgcgctccg cgccggcagc tactgcaccc tgcgcgaact gggctccact gagaccggct

5821 gcgagcgcac aagcggcgag cccgccacgc tgctgcacaa caccaccgtg gccatgtgca

5881 tggccatgcg catggtcccc aaaggcgtgc gctgggccgg gattttccag ggtgacgata

5941 tggtcatctt cctccccgag ggcgcgcgca gcgcggcact caagtggacc cccgccgagg

6001 tgggcttgtt tggcttccac atcccggtga agcacgtgag cacccctacc cccagcttct

6061 gcgggcacgt cggcaccgcg gccggcctct tccatgatgt catgcaccag gcgatcaagg

6121 tgctttgccg ccgtttcgac ccagacgtgc ttgaagaaca gcaggtggcc ctcctcgacc

6181 gcctccgggg ggtctacgcg gctctgcctg acaccgttgc cgccaatgct gcgtactacg

6241 actacagcgc ggagcgcgtc ctcgctatcg tgcgcgaact taccgcgtac gcgggggcgc

6301 ggcctcgacc acccggccac catcggcgcg ctcgaggaga ttcagacccc ctacgcgcgc

6361 gccaatctcc acgacgccga ctaacgcccc tgtacgtggg gcctttaatc ttacctactc

6421 taaccaggtc atcacccacc gttgtttcgc cgcatctggt gggtacccaa cttttgccat

6481 tcgggagagc cccagggtgc ccgaatggct tctactaccc ccatcaccat ggaggacctc

6541 cagaaggccc tcgaggcaca atcccgcgcc ctgcgcgcgg aactcgccgc cggcgcctcg

6601 cagtcgcgcc ggccgcggcc gccgcgacag cgcgactcca gcacctccgg agatgactcc

6661 ggccgtgact ccggagggcc ccgccgccgc cgcggcaacc ggggccgtgg ccagcgcagg

6721 gactggtcca gggccccgcc ccccccggag gagcggcaag aaactcgctc ccagactccg

6781 gccccgaagc catcgcgggc gccgccacaa cagcctcaac ccccgcgcat gcaaaccggg

6841 cgtgggggct ctgccccgcg ccccgagctg gggccaccga ccaacccgtt ccaagcagcc

6901 gtggcgcgtg gcctgcgccc gcctctccac gaccctgaca ccgaggcacc caccgaggcc

6961 tgcgtgacct cgtggctttg gagcgagggc gaaggcgcgg tcttttaccg cgtcgacctg

7021 catttcacca acctgggcac ccccccactc gacgaggacg gccgctggga ccctgcgctc

7081 atgtacaacc cttgcgggcc cgagccgccc gctcacgtcg tccgcgcgta caatcaacct

7141 gccggcgacg tcaggggcgt ttggggtaaa ggcgagcgca cctacgccga gcaggacttc

7201 cgcgtcggcg gcacgcgctg gcaccgactg ctgcgcatgc cagtgcgcgg cctcgacggc

7261 gacagcgccc cgcttccccc ccacaccacc gagcgcattg agacccgctc ggcgcgccat

7321 ccttggcgca tccgcttcgg tgccccccag gccttccttg ccgggctctt gctcgccacg

7381 gtcgccgttg gcaccgcgcg cgccgggctc cagccccgcg ctgatatggc ggcacctcct

7441 acgctgccgc agcccccctg tgcgcacggg cagcattacg gccaccacca ccatcagctg

7501 ccgttcctcg ggcacgacgg ccatcatggc ggcaccttgc gcgtcggcca gcattaccga

7561 aacgccagcg acgtgctgcc cggccactgg ctccaaggcg gctggggttg ctacaacctg

7621 agcgactggc accagggcac tcatgtctgt cataccaagc acatggactt ctggtgtgtg

7681 gagcacgacc gaccgccgcc cgcgaccccg acgcctctca ccaccgcggc gaactccacg

7741 accgccgcca cccccgccac tgcgccggcc ccctgccacg ccggcctcaa tgacagctgc

7801 ggcggcttct tgtctgggtg cgggccgatg cgcctgcgcc acggcgctga cacccggtgc

7861 ggtcggttga tctgcgggct gtccaccacc gcccagtacc cgcctacccg gtttggctgc

7921 gctatgcggt ggggccttcc cccctgggaa ctggtcgtcc ttaccgcccg ccccgaagac

7981 ggctggactt gccgcggcgt gcccgcccat ccaggcgccc gctgccccga actggtgagc

8041 cccatgggac gcgcgacttg ctccccagcc tcggccctct ggctcgccac agcgaacgcg

8101 ctgtctcttg atcacgccct cgcggccttc gtcctgctgg tcccgtgggt cctgatattt

8161 atggtgtgcc gccgcgcctg tcgccgccgc ggcgccgccg ccgccctcac cgcggtcgtc

8221 ctgcaggggt acaacccccc cgcctatggc gaggaggctt tcacctacct ctgcactgca

8281 ccggggtgcg ccactcaagc acctgtcccc gtgcgcctcg ctggcgtccg ttttgagtcc

8341 aagattgtgg acggcggctg ctttgcccca tgggacctcg aggccactgg agcctgcatt

8401 tgcgagatcc ccactgatgt ctcgtgcgag ggcttggggg cctgggtacc cgcagcccct

8461 tgcgcgcgca tctggaatgg cacacagcgc gcgtgcacct tctgggctgt caacgcctac

8521 tcctctggcg ggtacgcgca gctggcctct tacttcaacc ctggcggcag ctactacaag

8581 cagtaccacc ctaccgcgtg cgaggttgaa cctgccttcg gacacagcga cgcggcctgc

8641 tggggcttcc ccaccgacac cgtgatgagc gtgttcgccc ttgctagcta cgtccagcac

8701 cctcacaaga ccgtccgggt caagttccat acagagacca ggaccgtctg gcaactctcc

8761 gttgccggcg tgtcgtgcaa cgtcaccact gaacacccgt tctgcaacac gccgcacgga

8821 caactcgagg tccaggtccc gcccgacccc ggggacctgg ttgagtacat tatgaattac

8881 accggcaatc agcagtcccg gtggggcctc gggagcccga attgccacgg ccccgattgg

8941 gcctccccgg tttgccaacg ccattcccct gactgctcgc ggcttgtggg ggccacgcca

9001 gagcgccccc ggctgcgcct ggtcgacgcc gacgaccccc tgctgcgcac tgcccctgga

9061 cccggcgagg tgtgggtcac gcctgtcata ggctctcagg cgcgcaagtg cggactccac

9121 atacgcgctg gaccgtacgg ccatgctacc gtcgaaatgc ccgagtggat ccacgcccac

9181 accaccagcg acccctggca tccaccgggc cccttggggc tgaagttcaa gacagttcgc

9241 ccggtggccc tgccacgcac gttagcgcca ccccgcaatg tgcgtgtgac cgggtgctac

9301 cagtgcggta cccccgcgct ggtggaaggc cttgcccccg ggggaggcaa ttgccatctc

9361 accgtcaatg gcgaggacct cggcgccgtc ccccctggga agttcgtcac cgccgccctc

9421 ctcaacaccc ccccgcccta ccaagtcagc tgcgggggcg agagcgatcg cgcgaccgcg

9481 cgggtcatcg accccgccgc gcaatcgttt accggcgtgg tgtatggcac acacaccact

9541 gctgtgtcgg agacccggca gacctgggcg gagtgggctg ctgcccattg gtggcagctc

9601 actctgggcg ccatttgcgc cctcccactc gctggcttac tcgcttgctg tgccaaatgc

9661 ttgtactact tgcgcggcgc tatagcgcct cgctagtggg cccccgcgcg aaacccgcac

9721 taggccacta gatccccgca cctgttgctg tatag

References

  1. <pubmed>2353453</pubmed>

External Links

External Links Notice - The dynamic nature of the internet may mean that some of these listed links may no longer function. If the link no longer works search the web with the link text or name. Links to any external commercial sites are provided for information purposes only and should never be considered an endorsement. UNSW Embryology is provided as an educational resource with no clinical information or commercial affiliation.


Glossary Links

Glossary: A | B | C | D | E | F | G | H | I | J | K | L | M | N | O | P | Q | R | S | T | U | V | W | X | Y | Z | Numbers | Symbols | Term Link

Cite this page: Hill, M.A. (2019, August 25) Embryology Molecular Development - Rubella Genome. Retrieved from https://embryology.med.unsw.edu.au/embryology/index.php/Molecular_Development_-_Rubella_Genome

What Links Here?
© Dr Mark Hill 2019, UNSW Embryology ISBN: 978 0 7334 2609 4 - UNSW CRICOS Provider Code No. 00098G